PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KZV52622.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Gesneriaceae; Didymocarpoideae; Trichosporeae; Loxocarpinae; Dorcoceras
Family SRS
Protein Properties Length: 223aa    MW: 24752.9 Da    PI: 8.4174
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KZV52622.1genomeCNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702173.97.5e-54171605153
      DUF702   5 tasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasaaeaaskrkrelkskkqsalsstklssaeskkelets 103
                 + +CqdCGnqakkdC+h RCRtCCksrgf C+thvkstWvp++ r  r+++l ++ +++ +sa++ +++++r+ + k+  a      + + ++  l+  
  KZV52622.1  17 SRRCQDCGNQAKKDCQHLRCRTCCKSRGFVCETHVKSTWVPVSLRYPRHHTLMTK-QQQIHSATAVHHQEDRQPNPKRYRA----IYQLGPPSLGLQEG 110
                 568*******************************************997777665.4455555555555555543343333....33455667789999 PP

      DUF702 104 slPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGle 153
                 ++P e   +a frcvrvss+d   +++aY+t+vsi Ghvf GiLydqG+e
  KZV52622.1 111 DFPVEACLPAAFRCVRVSSLDSTIDQYAYHTSVSIRGHVFTGILYDQGPE 160
                 9***********************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051421.2E-5317160IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016231.3E-252059IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016249.6E-18112159IPR006511Lateral Root Primordium type 1, C-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 223 aa     Download sequence    Send to blast
MMRREERVAD SGVSLASRRC QDCGNQAKKD CQHLRCRTCC KSRGFVCETH VKSTWVPVSL  60
RYPRHHTLMT KQQQIHSATA VHHQEDRQPN PKRYRAIYQL GPPSLGLQEG DFPVEACLPA  120
AFRCVRVSSL DSTIDQYAYH TSVSIRGHVF TGILYDQGPE LEGTGNYATG ESSTSTGIGL  180
LQQEKFVPSI TATATGTSST PYPLPFCPFT ATAAQFFDQH PKS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011088766.12e-82PREDICTED: protein SHI RELATED SEQUENCE 1-like
SwissprotQ9XGX02e-45SHI_ARATH; Protein SHORT INTERNODES
TrEMBLS8BY382e-67S8BY38_9LAMI; Uncharacterized protein (Fragment)
STRINGSolyc01g110140.2.19e-60(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA41562445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66350.12e-46Lateral root primordium (LRP) protein-related